Gene soybn_pan_p012238


Sequence ID soybn_pan_p012238  add to my list
Species Glycine max
Alias No gene alias
Pangenome status Core (2/2)
Length 97aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 97 amino acids

>soybn_pan_p012238_SOYBN
MAASNIRDVNFASIFHSETIRIANVVEVKVGFHCDECIKKILKAIKKIEDIEKYNVNKQL
NKVIVTGNVTTEEVIRVLQKIGKNATPWENPKPQPNC


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP240412 Unannotated cluster
3 GP342479 Unannotated cluster
4 GP464531 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for soybn_pan_p012238



Represented sequence(s):
SOYBN_ZH13
SoyZH13_02G239700.m1
SOYBN_Wm82_a2_v1.0
Glyma02g42850.2
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
MELO3C019982.2.1 orthology 0.718 5 - -
Manes.07G136400.1 orthology 0.524 4 - -
cicar_pan_p006875 orthology 0.316 3 - -
cucsa_pan_p000399 orthology 0.685 5 - -
medtr_pan_p025150 orthology 0.335 3 - -
phavu.G19833.gnm2.ann1.Phvul.008G219600.1 orthology 0.144 1 - -
soybn_pan_p043843 ultra-paralogy 0.118 0 - -