Gene soybn_pan_p020075
| Sequence ID | soybn_pan_p020075 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 115aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 115 amino acids
>soybn_pan_p020075_SOYBN MRCEILHAGIDSLDIDMDQQKVTVTGYVEKGKVLRIVRRTGRKAEYWPFPYDSEYYPYAS EYLDESTFASSYNYYRHGYNESVYGYFPDQAYCTVQDETVFLFSDDNVHAPCTIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p020075
Represented sequence(s):
SOYBN_ZH13
SOYBN_Wm82_a2_v1.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G56891.1 | orthology | 0.911 | 10 | - | - |
| Ca_28_123.1 | orthology | 0.73 | 11 | - | - |
| Ca_31_155.3 | orthology | 0.686 | 11 | - | - |
| Ca_64_676.1 | orthology | 0.647 | 11 | - | - |
| Ca_78_1273.1 | orthology | 0.686 | 11 | 107 | 4.18e-31 |
| Cc06_g21060 | orthology | 0.601 | 11 | 95.5 | 1.02e-26 |
| Cg6g011520.1 | orthology | 0.317 | 5 | 189 | 2.35e-63 |
| Cs6g10930.1 | orthology | 0.311 | 5 | 189 | 2.33e-63 |
| DCAR_016949 | orthology | 0.747 | 11 | 130 | 1.09e-40 |
| FvH4_2g26780.1 | orthology | 0.417 | 7 | 120 | 8.44e-36 |
| MELO3C019416.2.1 | orthology | 0.461 | 7 | 158 | 2.19e-51 |
| Manes.08G099200.1 | orthology | 0.409 | 7 | 171 | 2.85e-56 |
| Oeu053981.1 | orthology | 0.668 | 12 | 154 | 4.03e-50 |
| brana_pan_p032952 | orthology | 1 | 11 | - | - |
| brana_pan_p033418 | orthology | 1 | 12 | - | - |
| brana_pan_p049288 | orthology | 1 | 10 | - | - |
| braol_pan_p001934 | orthology | 1 | 11 | - | - |
| braol_pan_p038031 | orthology | 1 | 11 | - | - |
| brarr_pan_p006813 | orthology | 1 | 12 | - | - |
| brarr_pan_p018750 | orthology | 1 | 10 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 | orthology | 0.0877 | 1 | 218 | 3.04e-75 |
| cucsa_pan_p011351 | orthology | 0.494 | 7 | 172 | 7.05e-57 |
| ipotf_pan_p003030 | orthology | 0.827 | 13 | 142 | 9.76e-45 |
| itb11g01700.t1 | orthology | 0.823 | 13 | 141 | 1.49e-44 |
| maldo_pan_p024328 | orthology | 0.501 | 7 | 117 | 4.78e-35 |
| maldo_pan_p038662 | orthology | 0.407 | 7 | - | - |
| medtr_pan_p030129 | orthology | 0.225 | 3 | 200 | 2.36e-68 |
| phavu.G19833.gnm2.ann1.Phvul.004G052700.1 | orthology | 0.123 | 2 | 216 | 3.58e-74 |
| thecc_pan_p019791 | orthology | 0.335 | 6 | 122 | 6.77e-37 |
| vitvi_pan_p003255 | orthology | 0.458 | 9 | - | - |