Gene soybn_pan_p020075
Sequence ID | soybn_pan_p020075 add to my list | ||
---|---|---|---|
Species | Glycine max | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 115aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 115 amino acids
>soybn_pan_p020075_SOYBN MRCEILHAGIDSLDIDMDQQKVTVTGYVEKGKVLRIVRRTGRKAEYWPFPYDSEYYPYAS EYLDESTFASSYNYYRHGYNESVYGYFPDQAYCTVQDETVFLFSDDNVHAPCTIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p020075
Represented sequence(s):
SOYBN_ZH13
SOYBN_Wm82_a2_v1.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G56891.1 | orthology | 0.911 | 10 | - | - |
Ca_28_123.1 | orthology | 0.73 | 11 | - | - |
Ca_31_155.3 | orthology | 0.686 | 11 | - | - |
Ca_64_676.1 | orthology | 0.647 | 11 | - | - |
Ca_78_1273.1 | orthology | 0.686 | 11 | 107 | 4.18e-31 |
Cc06_g21060 | orthology | 0.601 | 11 | 95.5 | 1.02e-26 |
Cg6g011520.1 | orthology | 0.317 | 5 | 189 | 2.35e-63 |
Cs6g10930.1 | orthology | 0.311 | 5 | 189 | 2.33e-63 |
DCAR_016949 | orthology | 0.747 | 11 | 130 | 1.09e-40 |
FvH4_2g26780.1 | orthology | 0.417 | 7 | 120 | 8.44e-36 |
MELO3C019416.2.1 | orthology | 0.461 | 7 | 158 | 2.19e-51 |
Manes.08G099200.1 | orthology | 0.409 | 7 | 171 | 2.85e-56 |
Oeu053981.1 | orthology | 0.668 | 12 | 154 | 4.03e-50 |
brana_pan_p032952 | orthology | 1 | 11 | - | - |
brana_pan_p033418 | orthology | 1 | 12 | - | - |
brana_pan_p049288 | orthology | 1 | 10 | - | - |
braol_pan_p001934 | orthology | 1 | 11 | - | - |
braol_pan_p038031 | orthology | 1 | 11 | - | - |
brarr_pan_p006813 | orthology | 1 | 12 | - | - |
brarr_pan_p018750 | orthology | 1 | 10 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 | orthology | 0.0877 | 1 | 218 | 3.04e-75 |
cucsa_pan_p011351 | orthology | 0.494 | 7 | 172 | 7.05e-57 |
ipotf_pan_p003030 | orthology | 0.827 | 13 | 142 | 9.76e-45 |
itb11g01700.t1 | orthology | 0.823 | 13 | 141 | 1.49e-44 |
maldo_pan_p024328 | orthology | 0.501 | 7 | 117 | 4.78e-35 |
maldo_pan_p038662 | orthology | 0.407 | 7 | - | - |
medtr_pan_p030129 | orthology | 0.225 | 3 | 200 | 2.36e-68 |
phavu.G19833.gnm2.ann1.Phvul.004G052700.1 | orthology | 0.123 | 2 | 216 | 3.58e-74 |
thecc_pan_p019791 | orthology | 0.335 | 6 | 122 | 6.77e-37 |
vitvi_pan_p003255 | orthology | 0.458 | 9 | - | - |