Gene soybn_pan_p020347
| Sequence ID | soybn_pan_p020347 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 157aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 157 amino acids
>soybn_pan_p020347_SOYBN MGVGDYWSDLMGSGNGNHQHNNKNKNKKQLQTVELKVMMDCDGCVLKVRKTLSSLDGVES VEINRKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYVPFNMVANPYTVQAYDKKAPPGY VRRVDNSAATIGTVTTAYADSYTTMFSDENPNACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p020347
Represented sequence(s):
SOYBN_Wm82_a2_v1.0
SOYBN_ZH13
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Oeu028401.1 | orthology | 0.402 | 3 | - | - |
| Oeu045782.1 | orthology | 0.403 | 3 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_19470.1 | orthology | 0.194 | 2 | 230 | 5.87e-79 |
| phavu.G19833.gnm2.ann1.Phvul.001G250300.1 | orthology | 0.0888 | 1 | 250 | 9.96e-87 |
| soybn_pan_p028650 | ultra-paralogy | 0.0731 | 0 | - | - |