Gene soybn_pan_p021093
| Sequence ID | soybn_pan_p021093 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 171aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 171 amino acids
>soybn_pan_p021093_SOYBN MSLKSSKRRMRNGFMCHSEASTAVCIAGSVVVPRTRSRRHQRSVSLDGTRLINYAKYSKL VDSSTSSRFNSAHKKCDSDSVSVPNIKHQENESRELQKKPTDNVFQVVVMRVAIHCQGCA GKVKKHLSKMEGVTSFSVDVESKRVTVMGHISPVGVLESISKVKRAEFWDC
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p021093
Represented sequence(s):
SOYBN_ZH13
SOYBN_Wm82_a2_v1.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_5g30890.1 | orthology | 0.671 | 5 | - | - |
| Oeu026170.2 | orthology | 0.752 | 3 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22288.1 | orthology | 0.134 | 2 | 265 | 2.76e-92 |
| cocnu_pan_p025689 | orthology | 0.58 | 4 | - | - |
| maldo_pan_p006499 | orthology | 0.863 | 5 | 115 | 1.49e-32 |
| phavu.G19833.gnm2.ann1.Phvul.006G207900.1 | orthology | 0.259 | 2 | 223 | 1.52e-75 |
| soybn_pan_p029731 | ultra-paralogy | 0.0559 | 0 | - | - |