Gene soybn_pan_p021997
| Sequence ID | soybn_pan_p021997 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 135aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 135 amino acids
>soybn_pan_p021997_SOYBN MGKLGRVLDTFCLSFGSNTCFCMNSMEFEDEFEKKPLIVSDSDHKLRLKDVVDGKQTLAF QLKPQIVTLRVSMHCHGCAKKVEKHISKLEGVSSYKVDLETKIVVVMGDILPSEVLQSVS KVKNAELWNFQASKE
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p021997
Represented sequence(s):
SOYBN_ZH13
SOYBN_Wm82_a2_v1.0
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. Glyma07g09760.1 | 0.00 | 3.78 | 13.51 | -0.00 |
| 2. Glyma09g32030.1 | 3.78 | 0.00 | 10.15 | 3.78 |
| 3. SoyZH13_09G169500.m1 | 13.51 | 10.15 | 0.00 | 13.51 |
| 4. SoyZH13_07G083200.m1 | -0.00 | 3.78 | 13.51 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| MELO3C025323.2.1 | orthology | 0.533 | 4 | 109 | 3.22e-32 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_27569.1 | orthology | 0.0456 | 1 | 259 | 3.55e-91 |
| cucsa_pan_p016074 | orthology | 0.517 | 4 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.004G161300.1 | orthology | 0.0526 | 2 | 253 | 1.34e-88 |