Gene soybn_pan_p022429
Sequence ID | soybn_pan_p022429 add to my list | ||
---|---|---|---|
Species | Glycine max | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 146aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 146 amino acids
>soybn_pan_p022429_SOYBN MGALDFLSDYFSVSTPKKKRKPMQTVEIKVKMDCDGCERRVRNSVSNMSGVKQVEVNRKQ SKVTVTGYVDRNKVLKKVQSTGKRAEFWPYIQYNLVAYPYVVQAYDKKAPSGYVKNTEQA LPNPNAPDEKLTSLFSDDNPNACSIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p022429
Represented sequence(s):
SOYBN_ZH13
SOYBN_Wm82_a2_v1.0
1. | 2. | 3. | 4. | |
---|---|---|---|---|
1. Glyma10g41040.1 | 0.00 | 2.78 | -0.00 | 2.78 |
2. Glyma20g26230.1 | 2.78 | 0.00 | 2.78 | -0.00 |
3. SoyZH13_10G244500.m1 | -0.00 | 2.78 | 0.00 | 2.78 |
4. SoyZH13_20G112900.m1 | 2.78 | -0.00 | 2.78 | 0.00 |