Gene soybn_pan_p023045
| Sequence ID | soybn_pan_p023045 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 178aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 178 amino acids
>soybn_pan_p023045_SOYBN MASLLQKAFGSEISSFIYRLFIYQNHNKGIPRNFKMPKKGRPLSLQTVELKVRMCCTGCE RVVKNAIYKLKGIDSVEVDLEMERVRVGGYVDRNKVLKAVRRAGKRAEFWPYPNPPLYFT SADHYFKDTTHEFKESYNYYRHGYNLPERHGTMHVSHRGDDNVSNMFNDDNVNACHIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p023045
Represented sequence(s):
SOYBN_ZH13
SOYBN_Wm82_a2_v1.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G18196.1 | orthology | 0.449 | 4 | - | - |
| brana_pan_p040174 | orthology | 0.489 | 5 | - | - |
| braol_pan_p005703 | orthology | 0.489 | 6 | - | - |
| brarr_pan_p015631 | orthology | 0.489 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_07046.1 | orthology | 0.11 | 1 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.007G117600.1 | orthology | 0.0862 | 2 | - | - |
| soybn_pan_p021167 | ultra-paralogy | 0.0268 | 0 | - | - |