Gene soybn_pan_p025312
Sequence ID | soybn_pan_p025312 add to my list | ||
---|---|---|---|
Species | Glycine max | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 168aa | ||
Gene Ontology |
![]()
|
Length: 168 amino acids
>soybn_pan_p025312_SOYBN MTSLKSSERKMMKRGFMCHSRASTAVCMSTRDPRSVVVPKKLERRVFLDDTRLINYAKYS KLVEPPRSSPVPKIKLRGQEQDQANNEPREFQKKQTDNNVFQVVVMRVAIHCQGCAGKVK KHLSKMEGVTSFSIDVESKRVTVMGHISPVEVLESISKVKRAEFWTAC
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p025312
Represented sequence(s):
SOYBN_Wm82_a2_v1.0
SOYBN_ZH13
1. | 2. | 3. | 4. | |
---|---|---|---|---|
1. Glyma08g07911.1 | 0.00 | 6.22 | 6.87 | -0.00 |
2. Glyma05g24751.1 | 6.22 | 0.00 | 0.60 | 5.91 |
3. SoyZH13_05G109000.m1 | 6.87 | 0.60 | 0.00 | 6.59 |
4. SoyZH13_08G070900.m1 | -0.00 | 5.91 | 6.59 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
FvH4_5g30890.1 | orthology | 0.713 | 5 | - | - |
Oeu026170.2 | orthology | 0.794 | 3 | 107 | 1.73e-30 |
cajca.ICPL87119.gnm1.ann1.C.cajan_22881.1 | orthology | 0.0932 | 2 | 281 | 1.6e-98 |
cocnu_pan_p025689 | orthology | 0.622 | 4 | - | - |
maldo_pan_p006499 | orthology | 0.904 | 5 | - | - |
phavu.G19833.gnm2.ann1.Phvul.002G207200.1 | orthology | 0.0963 | 2 | 291 | 1.19e-102 |