Gene soybn_pan_p025671


Sequence ID soybn_pan_p025671  add to my list
Species Glycine max
Alias No gene alias
Pangenome status Core (2/2)
Length 144aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 144 amino acids

>soybn_pan_p025671_SOYBN
MGALDYLSNFCTVTSTRTKQKAMQTAEIKVRMDCDGCERRVRNAVSSIKGVKSVEVNRKE
SRVVVRGYVDPKKVLKRVRSTGKVRAQFWPYVEQHLVYHPYAPGVYDRRAPSGYVRNVFQ
PSSHAQDNFLSFFSDDNVNACSIM


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for soybn_pan_p025671



Represented sequence(s):
SOYBN_Wm82_a2_v1.0
Glyma19g00840.1
SOYBN_ZH13
SoyZH13_19G001000.m1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
MELO3C020306.2.1 orthology 0.439 5 212 8.94e-72
cajca.ICPL87119.gnm1.ann1.C.cajan_32061.1 orthology 0.156 1 250 3.75e-87
cucsa_pan_p006945 orthology 0.444 5 208 9.28e-71
medtr_pan_p021579 orthology 0.326 3 222 6.83e-76
phavu.G19833.gnm2.ann1.Phvul.004G001200.1 orthology 0.189 2 250 5.15e-87
soybn_pan_p022431 ultra-paralogy 0.0687 0 - -
soybn_pan_p036295 ultra-paralogy 0.27 0 - -
soybn_pan_p036417 ultra-paralogy 0.201 0 - -
soybn_pan_p037957 ultra-paralogy 0.468 0 - -
soybn_pan_p038110 ultra-paralogy 0.0447 0 - -
soybn_pan_p043279 ultra-paralogy 0.316 0 - -