Gene soybn_pan_p030261
Sequence ID | soybn_pan_p030261 add to my list | ||
---|---|---|---|
Species | Glycine max | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 154aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 154 amino acids
>soybn_pan_p030261_SOYBN MVVQGGSQESPKAESKPEENPEEKKEPKPQSPCVLFVDLHCKGCAKKIKKSIMKMRGVWG VVIDMAENEVTIKGIVEPQAICNIISKKTKKRAQVISPLPEAAEGEPIPEAVTSQASEPV TVELKISMHCEACAKQLKRKILKMRGTTYYIFSF
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP126431 | Unannotated cluster |
4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p030261
Represented sequence(s):
SOYBN_Wm82_a2_v1.0
SOYBN_ZH13
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cajca.ICPL87119.gnm1.ann1.C.cajan_15858.1 | orthology | 0.266 | 2 | 200 | 5.06e-67 |
phavu.G19833.gnm2.ann1.Phvul.009G038800.2 | orthology | 0.328 | 1 | - | - |
soybn_pan_p009444 | ultra-paralogy | 0.176 | 0 | - | - |