Gene soybn_pan_p030977
| Sequence ID | soybn_pan_p030977 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 145aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 145 amino acids
>soybn_pan_p030977_SOYBN MGALNYIISNFCTVPSKKIKTMQTVEIKVKMDCDGCERKVRNAVATIKGVKSVEINRKQS RVTVNGCVDPNKVLNRVKRTGKKRAEFWPYVAQHVVTYPHASGIYDKRAPGGYVRNVQTF TPSADTEEKFMSLFSEDNVNACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p030977
Represented sequence(s):
SOYBN_Wm82_a2_v1.0
SOYBN_ZH13
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. Glyma02g10090.1 | 0.00 | 3.51 | -0.00 | 3.51 |
| 2. Glyma18g52880.1 | 3.51 | 0.00 | 3.51 | -0.00 |
| 3. SoyZH13_02G085100.m1 | -0.00 | 3.51 | 0.00 | 3.51 |
| 4. SoyZH13_18G259700.m1 | 3.51 | -0.00 | 3.51 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| cajca.ICPL87119.gnm1.ann1.C.cajan_19048.1 | orthology | 0.15 | 2 | 264 | 1.57e-92 |
| cicar_pan_p020432 | orthology | 0.249 | 4 | 246 | 9.46e-86 |
| medtr_pan_p015314 | orthology | 0.258 | 4 | 240 | 8.11e-83 |
| phavu.G19833.gnm2.ann1.Phvul.004G077300.1 | orthology | 0.306 | 1 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.006G017000.1 | orthology | 0.27 | 1 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.008G010200.1 | orthology | 0.0847 | 1 | 278 | 4.76e-98 |
| phavu.G19833.gnm2.ann1.Phvul.L002137.1 | orthology | 0.311 | 1 | - | - |