Gene soybn_pan_p032804


Sequence ID soybn_pan_p032804  add to my list
Species Glycine max
Alias No gene alias
Pangenome status Core (2/2)
Length 142aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 142 amino acids

>soybn_pan_p032804_SOYBN
MTIIEMRVHMDCPGCENKVKSALQKLKGVDDIEIDMSLQKVTVNGYADQKKVLKTVRKTG
RRAELWQLPYTTDSQNQYVQQHHCNGPINYYASQTSSSYNYYKHGYDSSDPRYYNYPSQS
SIFGYQTGATFSDDNPHACAIM



Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397
Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for soybn_pan_p032804



Represented sequence(s):
SOYBN_Wm82_a2_v1.0
SOYBN_ZH13

  1. 2. 3. 4.
1. Glyma12g33810.1 0.00 3.59 -0.00 3.72
2. Glyma13g36680.2 3.59 0.00 3.59 -0.00
3. SoyZH13_12G189200.m1 -0.00 3.59 0.00 3.72
4. SoyZH13_13G265800.m1 3.72 -0.00 3.72 0.00


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT1G06330.1 orthology 0.577 8 184 3.52e-61
Cg2g008690.1 orthology 0.483 7 213 1.75e-72
Cm103060.1 orthology 0.477 8 213 2.07e-72
Cs2g15540.1 orthology 0.477 8 216 1.46e-73
FvH4_6g27360.1 orthology 0.56 7 190 2.6e-63
MELO3C018725.2.1 orthology 0.637 8 184 3.81e-61
Manes.15G048400.1 orthology 0.312 4 224 7.31e-77
brana_pan_p013116 orthology 0.553 9 182 6.83e-60
braol_pan_p024201 orthology 0.553 9 182 6.2e-60
brarr_pan_p028890 orthology 0.553 9 182 5.52e-60
cajca.ICPL87119.gnm1.ann1.C.cajan_23872.1 orthology 0.0659 1 268 2.23e-94
cucsa_pan_p019751 orthology 0.629 8 181 8.39e-60
medtr_pan_p000903 orthology 0.166 3 251 1.07e-87
phavu.G19833.gnm2.ann1.Phvul.005G095400.1 orthology 0.0817 2 274 1.27e-96
thecc_pan_p014674 orthology 0.358 7 170 1.79e-55
vitvi_pan_p026446 orthology 0.496 7 206 1.52e-69