Gene soybn_pan_p037693
Sequence ID | soybn_pan_p037693 add to my list | ||
---|---|---|---|
Species | Glycine max | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 133aa | ||
Gene Ontology |
![]()
|
Length: 133 amino acids
>soybn_pan_p037693_SOYBN MPNGNAQNSRIECKDQQSSNFRRVIIYLIYLLSDWVSESDKIPSHSHKPTLQNQIVVLRV SLHCKARAGKVTKHISKMEGVTSFSIDMEAKKVTIIGHVTPLGVLASVSKVKNAQLWPSS TSSLPSLSSSMPR
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p037693
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
FvH4_3g34750.1 | orthology | 0.849 | 3 | - | - |
Manes.04G029700.1 | orthology | 0.862 | 3 | - | - |
Manes.11G135800.1 | orthology | 0.719 | 3 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_13578.1 | orthology | 0.266 | 1 | - | - |
maldo_pan_p016590 | orthology | 0.884 | 3 | - | - |
maldo_pan_p031809 | orthology | 0.895 | 3 | - | - |
soybn_pan_p006620 | ultra-paralogy | 0.194 | 0 | - | - |
soybn_pan_p035488 | ultra-paralogy | 0.116 | 0 | - | - |