Gene soybn_pan_p037693


Sequence ID soybn_pan_p037693  add to my list
Species Glycine max
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 133aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 133 amino acids

>soybn_pan_p037693_SOYBN
MPNGNAQNSRIECKDQQSSNFRRVIIYLIYLLSDWVSESDKIPSHSHKPTLQNQIVVLRV
SLHCKARAGKVTKHISKMEGVTSFSIDMEAKKVTIIGHVTPLGVLASVSKVKNAQLWPSS
TSSLPSLSSSMPR




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for soybn_pan_p037693



Represented sequence(s):
SOYBN_Wm82_a2_v1.0
Glyma13g40713.1
Unrepresented genome(s):
SOYBN_ZH13


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
FvH4_3g34750.1 orthology 0.849 3 - -
Manes.04G029700.1 orthology 0.862 3 - -
Manes.11G135800.1 orthology 0.719 3 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_13578.1 orthology 0.266 1 - -
maldo_pan_p016590 orthology 0.884 3 - -
maldo_pan_p031809 orthology 0.895 3 - -
soybn_pan_p006620 ultra-paralogy 0.194 0 - -
soybn_pan_p035488 ultra-paralogy 0.116 0 - -