Gene soybn_pan_p040036
| Sequence ID | soybn_pan_p040036 add to my list |
|---|---|
| Species | Glycine max |
| Alias | No gene alias |
| Pangenome status | Dispensable (1/2) |
| Length | 82aa |
Length: 82 amino acids
>soybn_pan_p040036_SOYBN YFCMVMRINIDYNGCYRKVKRALLDMPELDTHLLEKNRTSVVVCERFIPHDVAINIRIKT NRRIEILDLQFIFFPNFFLFSD
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Bv5_110870_wcqq.t1 | orthology | 1 | 7 | - | - |
| Bv5_110870_wcqq.t2 | orthology | 1 | 7 | - | - |
| CgUng002450.1 | orthology | 1 | 6 | - | - |
| Cm118330.1 | orthology | 1 | 5 | - | - |
| Cs7g26570.1 | orthology | 1 | 6 | - | - |
| FvH4_5g12320.1 | orthology | 1 | 5 | - | - |
| Manes.05G138100.1 | orthology | 0.943 | 2 | - | - |
| PGSC0003DMP400010112 | orthology | 1 | 2 | - | - |
| Solyc03g119630.2.1 | orthology | 1 | 3 | - | - |
| capan_pan_p000343 | orthology | 1 | 3 | - | - |
| cucsa_pan_p010693 | orthology | 1 | 7 | - | - |
| maldo_pan_p026714 | orthology | 1 | 5 | - | - |
| soybn_pan_p042566 | ultra-paralogy | 0.401 | 0 | - | - |
| thecc_pan_p001600 | orthology | 1 | 6 | - | - |
| vitvi_pan_p014384 | orthology | 1 | 5 | - | - |