Gene soybn_pan_p040952


Sequence ID soybn_pan_p040952  add to my list
Species Glycine max
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 107aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 107 amino acids

>soybn_pan_p040952_SOYBN
MTVKYFCMVMRINIDCNGCYRKVKRALLDMPELDTHLLEKNQTRVIVCGRFIPRDVAIMI
RKKTNRRVEILDIQDLSESNAEMEDQKPMTNNWTLLTTQNQMETCLA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR036163
Figure 1: IPR domains for soybn_pan_p040952



Represented sequence(s):
SOYBN_Wm82_a2_v1.0
Glyma07g10040.1
Unrepresented genome(s):
SOYBN_ZH13


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Bv5_110870_wcqq.t1 orthology 1 7 - -
Bv5_110870_wcqq.t2 orthology 1 7 - -
CgUng002450.1 orthology 0.795 6 - -
Cm118330.1 orthology 0.794 5 - -
Cs7g26570.1 orthology 0.795 6 - -
FvH4_5g12320.1 orthology 0.946 5 - -
Manes.05G138100.1 orthology 0.564 2 - -
PGSC0003DMP400010112 orthology 0.656 2 125 3.5e-38
Solyc03g119630.2.1 orthology 0.697 3 129 2.96e-40
capan_pan_p000343 orthology 0.823 3 - -
cucsa_pan_p010693 orthology 0.922 7 - -
maldo_pan_p026714 orthology 0.93 5 - -
thecc_pan_p001600 orthology 0.798 6 - -
vitvi_pan_p014384 orthology 0.683 5 - -