Gene soybn_pan_p043513
Sequence ID | soybn_pan_p043513 add to my list |
---|---|
Species | Glycine max |
Alias | No gene alias |
Pangenome status | Dispensable (1/2) |
Length | 50aa |
Length: 50 amino acids
>soybn_pan_p043513_SOYBN MAKATTNDNNSLLHLENLTLPSFQVVVIAANMGCNGCRGRVSRVVSKMTG
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP022701 | Unannotated cluster |
3 | GP047979 | Unannotated cluster |
4 | GP468909 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT2G35730.1 | orthology | 1 | 5 | - | - |
Cm212920.1 | orthology | 1 | 5 | - | - |
Manes.02G038800.1 | orthology | 1 | 5 | - | - |
brana_pan_p001635 | orthology | 1 | 6 | - | - |
brana_pan_p054319 | orthology | 1 | 6 | - | - |
braol_pan_p040844 | orthology | 1 | 6 | - | - |
braol_pan_p052965 | orthology | 1 | 6 | - | - |
brarr_pan_p008654 | orthology | 1 | 5 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_01523.1 | orthology | 0.173 | 2 | - | - |
cicar_pan_p024775 | orthology | 0.29 | 3 | - | - |
cucsa_pan_p023048 | orthology | 1 | 5 | - | - |
maize_pan_p044279 | orthology | 0.722 | 4 | - | - |
medtr_pan_p004416 | orthology | 0.391 | 3 | - | - |
phavu.G19833.gnm2.ann1.Phvul.003G219900.1 | orthology | 0.189 | 2 | - | - |
soybn_pan_p039239 | ultra-paralogy | 0.001 | 0 | - | - |
soybn_pan_p045249 | ultra-paralogy | 0.0673 | 0 | - | - |