Gene thecc_pan_p006409


Sequence ID thecc_pan_p006409  add to my list
Species Theobroma cacao
Alias No gene alias
Pangenome status Core (2/2)
Length 86aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 86 amino acids

>thecc_pan_p006409_THECC
MSQTVFLKVGMSCEGCVGAVKRVLGKMEGVESYEVDLKEQKVTVKGNVQPDAVLQTVSKT
GKKTTFWETEAPAEPEAKPAEAVATA


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for thecc_pan_p006409



Represented sequence(s):
THECC_Matina1_6_v1.1
Thecc1EG043707t1
THECC_Criollo_v2.0
Tc10v2_t008320.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
cajca.ICPL87119.gnm1.ann1.C.cajan_24641.1 orthology 0.328 3 114 2.92e-35
cicar_pan_p009659 orthology 0.403 2 111 3.46e-34
medtr_pan_p015003 orthology 0.404 2 125 1.09e-39
phavu.G19833.gnm2.ann1.Phvul.007G103800.1 orthology 0.316 3 125 9.87e-40
soybn_pan_p011435 orthology 0.298 2 130 2.88e-41
soybn_pan_p033763 orthology 0.299 2 - -
vitvi_pan_p027163 orthology 0.227 2 143 1.67e-46
vitvi_pan_p043448 orthology 0.243 2 - -
vitvi_pan_p043537 orthology 0.227 2 - -