Gene thecc_pan_p009145
Sequence ID | thecc_pan_p009145 add to my list | ||
---|---|---|---|
Species | Theobroma cacao | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 241aa | ||
Gene Ontology |
![]()
|
Length: 241 amino acids
>thecc_pan_p009145_THECC MGHGQQHQGGGQIVEVKLEKSCENNQEKGAKDSNKGKEIVLKVYMHCEGCAAKVFNCLKG FQGVEQVKTDMEGDRVIVKGQNADPLKILERVKKKYSRNAELISPKPKPKATDGKQSQNK QEPPIKFVVLKMYMHCEGCANDIKRSIGRMKGILNVEPDMKKSTVTVRGNFDPPKLVEAI AKQFGKYAEIVAEGPTDKANGTGKQGKEEEIMFHYPPQYSLQHIYPTQIFSDENILSCSI M
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for thecc_pan_p009145
Represented sequence(s):
1. | 2. | 3. | |
---|---|---|---|
1. Tc02v2_t017140.1 | 0.00 | 1.67 | 0.42 |
2. Tc03v2_t012970.1 | 1.67 | 0.00 | 1.67 |
3. Thecc1EG008612t1 | 0.42 | 1.67 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G02960.1 | orthology | 0.875 | 3 | 233 | 3.41e-77 |
Cg7g016680.1 | orthology | 0.907 | 4 | 214 | 1.67e-70 |
Cm174370.1 | orthology | 0.906 | 3 | 213 | 8.01e-70 |
Cs7g11080.1 | orthology | 0.914 | 4 | 226 | 1.17e-74 |
Manes.13G008700.1 | orthology | 0.779 | 2 | 240 | 1.7e-80 |
brana_pan_p048220 | orthology | 0.916 | 4 | 227 | 4.12e-74 |
braol_pan_p002896 | orthology | 0.909 | 4 | 223 | 4.46e-73 |
brarr_pan_p015545 | orthology | 0.905 | 3 | 227 | 1.9e-74 |
orange1.1t05450.1 | orthology | 0.914 | 4 | - | - |
thecc_pan_p020513 | ultra-paralogy | 0.198 | 0 | - | - |