Gene thecc_pan_p011891
| Sequence ID | thecc_pan_p011891 add to my list | ||
|---|---|---|---|
| Species | Theobroma cacao | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 156aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 156 amino acids
>thecc_pan_p011891_THECC MGFLDSVSELCDWPHFHSHKKIKKKQLQTVEIKVKMDCEGCEKRVKKSVEGMKGVTQVKV EPKQSKLTVIGYVDADKVLERVRHRTGKKVEFWPYVPYDVVPHPYAPGAYDKKAPPGYVR NVFQDPQAGELARASSFEVKYTTAFSDENPNACVIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for thecc_pan_p011891
Represented sequence(s):
THECC_Matina1_6_v1.1
THECC_Criollo_v2.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT5G66110.1 | orthology | 0.448 | 7 | 219 | 1.1e-74 |
| Cg1g001350.1 | orthology | 0.239 | 4 | 260 | 7.85e-91 |
| Cm173610.1 | orthology | 0.233 | 3 | - | - |
| Cm280940.1 | orthology | 0.233 | 3 | 268 | 8.32e-94 |
| Cs1g25820.1 | orthology | 0.233 | 4 | 265 | 8.91e-93 |
| MELO3C007926.2.1 | orthology | 0.391 | 7 | 248 | 3.76e-86 |
| Manes.01G148900.1 | orthology | 0.403 | 5 | 229 | 2.32e-78 |
| brana_pan_p030902 | orthology | 0.455 | 9 | 200 | 3.79e-67 |
| braol_pan_p039277 | orthology | 0.447 | 8 | - | - |
| brarr_pan_p021369 | orthology | 0.455 | 9 | - | - |
| cucsa_pan_p018650 | orthology | 0.391 | 7 | 248 | 3.53e-86 |
| maldo_pan_p003753 | orthology | 0.203 | 3 | 218 | 1.58e-74 |
| medtr_pan_p005386 | orthology | 0.28 | 1 | 250 | 1.27e-86 |