Gene thecc_pan_p013986
Sequence ID | thecc_pan_p013986 add to my list |
---|---|
Species | Theobroma cacao |
Alias | No gene alias |
Pangenome status | Core (2/2) |
Length | 80aa |
Length: 80 amino acids
>thecc_pan_p013986_THECC MATKYIIPAVLGSFAIAYVCDQLIADKKIFGGTTPSTVSNKEWWEETDKKFQAWPRTAGP PVVMNPISRQNFIVKAGSES
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for thecc_pan_p013986
Represented sequence(s):
THECC_Criollo_v2.0
THECC_Matina1_6_v1.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Bv_004250_qxzd.t1 | orthology | 0.381 | 4 | - | - |
Cc06_g16730 | orthology | 0.38 | 5 | 141 | 5.14e-46 |
FvH4_6g23630.1 | orthology | 0.24 | 2 | 144 | 4.78e-47 |
Oeu008921.2 | orthology | 0.546 | 5 | 135 | 2.35e-43 |
Oeu017948.1 | orthology | 0.536 | 5 | - | - |
ipotf_pan_p004891 | orthology | 0.779 | 4 | - | - |
ipotf_pan_p031007 | orthology | 0.579 | 5 | 134 | 2.19e-43 |
itb15g03700.t1 | orthology | 0.579 | 5 | 134 | 2.36e-43 |
maldo_pan_p043115 | orthology | 0.255 | 2 | 142 | 1.51e-45 |
vitvi_pan_p004955 | orthology | 0.287 | 2 | - | - |
vitvi_pan_p017163 | orthology | 0.281 | 2 | - | - |
vitvi_pan_p018667 | orthology | 0.281 | 2 | 150 | 1.38e-49 |
vitvi_pan_p036875 | orthology | 0.296 | 2 | - | - |