Gene thecc_pan_p013986


Sequence ID thecc_pan_p013986  add to my list
Species Theobroma cacao
Alias No gene alias
Pangenome status Core (2/2)
Length 80aa



Length: 80 amino acids

>thecc_pan_p013986_THECC
MATKYIIPAVLGSFAIAYVCDQLIADKKIFGGTTPSTVSNKEWWEETDKKFQAWPRTAGP
PVVMNPISRQNFIVKAGSES


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Unknown function duf1138 family
GP002478		 Unknown function duf1138 family
2 GP018276 Unannotated cluster
3 GP042981 Unannotated cluster
4 GP072479 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Protein of unknown function DUF1138
IPR009515 		Protein of unknown function DUF1138 Family

IPR009515
Figure 1: IPR domains for thecc_pan_p013986



Represented sequence(s):
THECC_Criollo_v2.0
Tc05v2_t013310.1
THECC_Matina1_6_v1.1
Thecc1EG024708t1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Bv_004250_qxzd.t1 orthology 0.381 4 - -
Cc06_g16730 orthology 0.38 5 141 5.14e-46
FvH4_6g23630.1 orthology 0.24 2 144 4.78e-47
Oeu008921.2 orthology 0.546 5 135 2.35e-43
Oeu017948.1 orthology 0.536 5 - -
ipotf_pan_p004891 orthology 0.779 4 - -
ipotf_pan_p031007 orthology 0.579 5 134 2.19e-43
itb15g03700.t1 orthology 0.579 5 134 2.36e-43
maldo_pan_p043115 orthology 0.255 2 142 1.51e-45
vitvi_pan_p004955 orthology 0.287 2 - -
vitvi_pan_p017163 orthology 0.281 2 - -
vitvi_pan_p018667 orthology 0.281 2 150 1.38e-49
vitvi_pan_p036875 orthology 0.296 2 - -