Gene thecc_pan_p016610
| Sequence ID | thecc_pan_p016610 add to my list | ||
|---|---|---|---|
| Species | Theobroma cacao | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 355aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 355 amino acids
>thecc_pan_p016610_THECC MPHIFCLSNIPYSCTNEIHLLILRSYSLLRHLHLSYKTIICSRFLHFPLLLGLMVPELEK ARVTEIQVRMDCNGCVQKIRKALHGIQGIYEVYPDITQQKLTVVGWADPERIVKAIRKTR KVATICSHSEPTEAAVQPTEQPPEGGPPAPEAVNPPPSEAPPAEAAPQPQSQPEAAPPAE PPKDQPPPENPQPEPARAPAAATDANASGQQPPQPSGPKDVGDVHVICQHPPDCGHRYGY VHSYGGPWSRQYPNNKGNFYPEPLSRHPNSQVFHHEPPQPAFVTHSYNTYKPSPYVTEYK YVHSPPRSTHYSRIDHYNEDYHNNYISGSSSSSSHGNGNITSMFSDENPNACRIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP047778 | Unannotated cluster |
| 4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for thecc_pan_p016610
Represented sequence(s):
THECC_Criollo_v2.0
THECC_Matina1_6_v1.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg9g002000.1 | orthology | 0.438 | 3 | 233 | 1.3e-74 |
| Cm229420.1 | orthology | 0.441 | 3 | 228 | 2.92e-72 |
| Cs9g03680.1 | orthology | 0.455 | 2 | 211 | 9.81e-66 |
| FvH4_4g18950.1 | orthology | 0.528 | 3 | 208 | 4.15e-65 |
| Manes.15G008800.1 | orthology | 0.468 | 2 | 258 | 2.53e-84 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04327.1 | orthology | 0.803 | 4 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_31773.1 | orthology | 0.664 | 5 | 199 | 1.74e-62 |
| cicar_pan_p002360 | orthology | 0.879 | 5 | 163 | 1.7e-48 |
| maldo_pan_p004517 | orthology | 0.538 | 3 | 245 | 1.31e-78 |
| maldo_pan_p022412 | orthology | 0.557 | 3 | - | - |
| medtr_pan_p024125 | orthology | 0.903 | 5 | 143 | 8.64e-41 |
| phavu.G19833.gnm2.ann1.Phvul.003G108900.1 | orthology | 0.877 | 5 | 171 | 2.76e-51 |
| soybn_pan_p005812 | orthology | 0.801 | 4 | 181 | 3.35e-55 |
| soybn_pan_p009634 | orthology | 0.835 | 5 | - | - |
| soybn_pan_p012740 | orthology | 0.635 | 5 | - | - |
| vitvi_pan_p020280 | orthology | 0.391 | 3 | 226 | 4.19e-72 |