Gene thecc_pan_p017549
Sequence ID | thecc_pan_p017549 add to my list | ||
---|---|---|---|
Species | Theobroma cacao | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 326aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 326 amino acids
>thecc_pan_p017549_THECC MWHPHQMLSILLFSYFFYSQPFSFPSRLSKPPFFSLSLSLSLSQMATKLADQDAAGALRY QTWVLKVLIHCEGCKKKVKKVLQGIDGVYETTIDSQQHKVTVTGSVDAETLIKRLTKSGK HVELWPEKPEKKEKKPGKPKNNEKQEDGGEAGGDQDPKNNSEEKPNLAAAKNGGAGGGKG PARDDQPPAGDQMGSESEEPATAESGGGNGGKKKKKKGPKGNPGPTADALGDNLSAALAL PEQAPPMASMHLSPPNQPMYPYPPMCYGPPLYGVSYNTTYPSSSSSYYAPAMHANAYGPP PPPSDPIEKFNEDDDYDDDESGCSIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for thecc_pan_p017549
Represented sequence(s):
THECC_Matina1_6_v1.1
THECC_Criollo_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg5g037020.1 | orthology | 0.529 | 2 | 168 | 2.31e-50 |
Cm177940.1 | orthology | 0.541 | 3 | 168 | 5.48e-50 |
Cs5g32830.1 | orthology | 0.54 | 3 | 166 | 1.96e-49 |
FvH4_2g25240.1 | orthology | 1 | 6 | 154 | 9.69e-45 |
FvH4_3g05420.1 | orthology | 1 | 6 | - | - |
Manes.01G216400.1 | orthology | 0.919 | 4 | 162 | 1.2e-47 |
Manes.05G064600.1 | orthology | 0.991 | 4 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_10299.1 | orthology | 0.946 | 3 | 134 | 5.17e-37 |
cicar_pan_p013771 | orthology | 0.981 | 3 | 118 | 3.77e-31 |
maldo_pan_p006711 | orthology | 0.989 | 6 | 157 | 3.02e-45 |
maldo_pan_p033280 | orthology | 0.958 | 6 | - | - |
medtr_pan_p025269 | orthology | 0.994 | 3 | 128 | 1.34e-34 |
phavu.G19833.gnm2.ann1.Phvul.001G205300.1 | orthology | 1 | 4 | 149 | 1.18e-42 |
soybn_pan_p005697 | orthology | 0.951 | 4 | 147 | 8.35e-42 |
soybn_pan_p010098 | orthology | 0.976 | 4 | - | - |
vitvi_pan_p002541 | orthology | 0.914 | 5 | 145 | 1.81e-41 |