Gene thecc_pan_p019021
| Sequence ID | thecc_pan_p019021 add to my list | ||
|---|---|---|---|
| Species | Theobroma cacao | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 179aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 179 amino acids
>thecc_pan_p019021_THECC MATLLARAFGSIISVIASCFFGYRDNKKGFSNINYYNMPKGRPLSLQTVDLKVRMCCTGC ERVVKNAIYKLRGIDSVEVDLEMEKVTVIGYVDRNKVLKQVRRAGKRAEFWPYPDPPLYF TSTNEYFKDTTNEFKESYNYYRHGYNLGHRHGNIPVTHRGDDKVSNMFNDDNVNACCLM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for thecc_pan_p019021
Represented sequence(s):
THECC_Criollo_v2.0
THECC_Matina1_6_v1.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg5g000180.1 | orthology | 0.197 | 4 | 250 | 3.64e-86 |
| Cm244380.1 | orthology | 0.202 | 3 | 247 | 1.01e-84 |
| Cs5g01190.1 | orthology | 0.197 | 4 | 250 | 3.96e-86 |
| Manes.02G000100.1 | orthology | 0.203 | 1 | 255 | 6.28e-88 |