Gene thecc_pan_p021026
Sequence ID | thecc_pan_p021026 add to my list | ||
---|---|---|---|
Species | Theobroma cacao | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 90aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 90 amino acids
>thecc_pan_p021026_THECC MSGRLCCMVMRVNIDCHGCYRKMRRILLNIKEVETHVIEKQQCRVSICGRFGPSDVAIKI RKRMNRRVEILEIQEISEEQTDQTPMVSSQ
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP109350 | Unannotated cluster |
3 | GP119142 | Unannotated cluster |
4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for thecc_pan_p021026
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Bv6_142170_makm.t1 | orthology | 0.832 | 2 | - | - |
sorbi_pan_p014632 | orthology | 1 | 2 | - | - |
thecc_pan_p012357 | ultra-paralogy | 0.0713 | 0 | - | - |