Gene thecc_pan_p022195
| Sequence ID | thecc_pan_p022195 add to my list |
|---|---|
| Species | Theobroma cacao |
| Alias | No gene alias |
| Pangenome status | Dispensable (1/2) |
| Length | 123aa |
Length: 123 amino acids
>thecc_pan_p022195_THECC MLLRDRSPNRTTGYRIVVSVISVQCSQWLLLLTRATEVCGICHVSVLGRDRWILVKIART PRHLQGLVIACSSAANLGNMLLIILPAICEETNSPFGDSSTCAAYGEAYASLSLAILSKT FDP
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Auxin efflux carrier family
GP000355 |
Auxin efflux carrier family |
| 2 | GP015273 | Unannotated cluster |
| 3 | GP040583 | Unannotated cluster |
| 4 | GP463648 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):