Gene tritu_pan_p004118
Sequence ID | tritu_pan_p004118 add to my list | ||
---|---|---|---|
Species | Triticum turgidum | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 96aa | ||
Gene Ontology |
![]()
|
Length: 96 amino acids
>tritu_pan_p004118_TRITU MDYRQFYCMTLRMSIDCNGCYQKIRRALLQMQELESHLIDRKHGRVSVWGAFSPQDVAIK IRKRTNRRVEILELREAAGPGGADEQGAGGGQMPSN
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP109350 | Unannotated cluster |
3 | GP119142 | Unannotated cluster |
4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p004118
Represented sequence(s):
TRITU_Svevo_v2.0
TRITU_Zavitan_v1.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
ORGLA09G0073900.1 | orthology | 0.418 | 3 | 139 | 8.48e-42 |
bradi_pan_p028263 | orthology | 0.355 | 2 | - | - |
maize_pan_p009159 | orthology | 0.428 | 3 | - | - |
musac_pan_p023320 | orthology | 0.748 | 3 | 117 | 8.39e-36 |
orysa_pan_p037625 | orthology | 0.525 | 3 | - | - |
sorbi_pan_p029803 | orthology | 0.326 | 3 | - | - |
tritu_pan_p024914 | ultra-paralogy | 0.0348 | 0 | - | - |
tritu_pan_p040052 | ultra-paralogy | 0.0239 | 0 | - | - |
tritu_pan_p048949 | ultra-paralogy | 0.118 | 0 | - | - |