Gene tritu_pan_p004118


Sequence ID tritu_pan_p004118  add to my list
Species Triticum turgidum
Alias No gene alias
Pangenome status Core (2/2)
Length 96aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 96 amino acids

>tritu_pan_p004118_TRITU
MDYRQFYCMTLRMSIDCNGCYQKIRRALLQMQELESHLIDRKHGRVSVWGAFSPQDVAIK
IRKRTNRRVEILELREAAGPGGADEQGAGGGQMPSN


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for tritu_pan_p004118



Represented sequence(s):
TRITU_Svevo_v2.0
TRIDC5Av2G141000.1
TRITU_Zavitan_v1.1
TraesCS5A02G206500.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
ORGLA09G0073900.1 orthology 0.418 3 139 8.48e-42
bradi_pan_p028263 orthology 0.355 2 - -
maize_pan_p009159 orthology 0.428 3 - -
musac_pan_p023320 orthology 0.748 3 117 8.39e-36
orysa_pan_p037625 orthology 0.525 3 - -
sorbi_pan_p029803 orthology 0.326 3 - -
tritu_pan_p024914 ultra-paralogy 0.0348 0 - -
tritu_pan_p040052 ultra-paralogy 0.0239 0 - -
tritu_pan_p048949 ultra-paralogy 0.118 0 - -