Gene tritu_pan_p008561
Sequence ID | tritu_pan_p008561 add to my list | ||
---|---|---|---|
Species | Triticum turgidum | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 140aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 140 amino acids
>tritu_pan_p008561_TRITU MGEENAASANSVTVNVRVYMHCDACERSVRRTIKKIDGVETVEVDREENKVMVTGDFKAE KVLRKLKKKTGKKAEILPPDPEEENQEEEKQEPDDDAYAPYGYGRPAPDMDAVLGNEFQR PPRWDLHYFDDENTEASRIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP489053 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p008561
Represented sequence(s):
1. | 2. | 3. | |
---|---|---|---|
1. TRIDC2Av2G208190.2 | 0.00 | 5.89 | 8.98 |
2. TraesCS2A02G356600.1 | 5.89 | 0.00 | 3.64 |
3. TraesCS2D02G355500.1 | 8.98 | 3.64 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU2Hr1G086800.3 | orthology | 0.111 | 1 | - | - |
tritu_pan_p034417 | ultra-paralogy | 0.0617 | 0 | - | - |