Gene tritu_pan_p008810
| Sequence ID | tritu_pan_p008810 add to my list | ||
|---|---|---|---|
| Species | Triticum turgidum | ||
| Alias | No gene alias | ||
| Pangenome status | Dispensable (1/2) | ||
| Length | 79aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 79 amino acids
>tritu_pan_p008810_TRITU MVALHEKRVRKCLSKVKGVERVEVEGSIQKVVVTGYANRNKILKALRRVGLRVELWSPRN ELLSAYAAGSFAFNNYGFF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p008810
Represented sequence(s):
| 1. | 2. | |
|---|---|---|
| 1. TRIDC7Av2G081390.1 | 0.00 | -0.00 |
| 2. TRIDC7Bv2G062250.1 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_12_32.9 | orthology | 0.763 | 11 | 100 | 2e-29 |
| Ca_3_262.11 | orthology | 0.763 | 11 | - | - |
| Ca_455_136.3 | orthology | 0.763 | 11 | - | - |
| Ca_68_16.11 | orthology | 0.787 | 11 | - | - |
| Cc10_g00290 | orthology | 0.787 | 11 | 100 | 8.56e-30 |
| Cg3g025710.1 | orthology | 0.657 | 13 | 107 | 1.39e-32 |
| Cm122260.1 | orthology | 0.669 | 12 | 105 | 1.35e-31 |
| Cs3g27690.1 | orthology | 0.657 | 13 | 107 | 1.51e-32 |
| DCAR_023025 | orthology | 0.647 | 8 | 106 | 3.86e-32 |
| HORVU7Hr1G051110.3 | orthology | 0.265 | 1 | 120 | 1.11e-37 |
| MELO3C017056.2.1 | orthology | 0.803 | 13 | 98.6 | 5.22e-29 |
| Manes.05G127500.1 | orthology | 0.696 | 11 | - | - |
| Manes.18G002200.1 | orthology | 0.709 | 11 | 103 | 1.03e-30 |
| Mba08_g25790.1 | orthology | 0.395 | 5 | 128 | 1.18e-40 |
| ORGLA08G0178600.1 | orthology | 0.16 | 4 | 131 | 5.06e-42 |
| Oeu013567.1 | orthology | 0.667 | 9 | 115 | 1.32e-35 |
| XP_010932092.1 | orthology | 0.336 | 6 | 130 | 1.54e-41 |
| XP_017697769.1 | orthology | 0.361 | 6 | 129 | 4.14e-41 |
| XP_019707878.1 | orthology | 0.374 | 7 | - | - |
| bradi_pan_p007471 | orthology | 0.0571 | 2 | 143 | 1.61e-46 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 | orthology | 0.812 | 9 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 0.81 | 9 | 107 | 2.15e-32 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 | orthology | 0.808 | 8 | - | - |
| capan_pan_p037558 | orthology | 0.774 | 10 | 104 | 3.04e-31 |
| cicar_pan_p012771 | orthology | 0.93 | 10 | 105 | 9.83e-32 |
| cocnu_pan_p024788 | orthology | 0.336 | 6 | 130 | 9.43e-42 |
| cocnu_pan_p029661 | orthology | 0.4 | 7 | - | - |
| cucsa_pan_p017207 | orthology | 0.803 | 13 | 98.6 | 4.92e-29 |
| maldo_pan_p020708 | orthology | 0.693 | 11 | 100 | 2.71e-29 |
| medtr_pan_p031498 | orthology | 0.863 | 10 | 105 | 1.97e-31 |
| musac_pan_p036492 | orthology | 0.383 | 5 | 126 | 5.32e-40 |
| orysa_pan_p046260 | orthology | 0.135 | 4 | 131 | 7.76e-42 |
| phavu.G19833.gnm2.ann1.Phvul.002G208500.1 | orthology | 0.82 | 8 | 99.4 | 3.16e-29 |
| soybn_pan_p018879 | orthology | 0.863 | 8 | 100 | 1.58e-29 |
| soybn_pan_p037728 | orthology | 0.888 | 9 | - | - |
| soybn_pan_p037999 | orthology | 0.929 | 9 | - | - |
| soybn_pan_p041984 | orthology | 0.898 | 9 | - | - |
| thecc_pan_p004256 | orthology | 0.705 | 12 | 107 | 2.17e-32 |
| vitvi_pan_p014910 | orthology | 0.619 | 10 | 110 | 2.06e-33 |
| vitvi_pan_p031077 | orthology | 0.619 | 10 | - | - |