Gene tritu_pan_p012747


Sequence ID tritu_pan_p012747  add to my list
Species Triticum turgidum
Alias No gene alias
Pangenome status Core (2/2)
Length 122aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 122 amino acids

>tritu_pan_p012747_TRITU
MGDLQIVLAGGTIEAQHVEMKVPLYSYGCEKKIKKALSNLKGIHSVQVDYHQQKVTVWGI
CNRNDVLAAVRRKRRAARFWGADQPDLGEDARLGDAQKHYLRAFAAYRSRKSWKKLFPMI
RL


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP467872 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for tritu_pan_p012747



Represented sequence(s):
TRITU_Zavitan_v1.1
TraesCS2B02G412500.1
TRITU_Svevo_v2.0
TRIDC2Bv2G181360.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU2Hr1G093870.1 orthology 0.0181 1 242 1.48e-84
Mba04_g24060.1 orthology 0.736 6 148 2.22e-47
XP_008808278.1 orthology 0.823 6 - -
XP_010919018.1 orthology 0.83 7 - -
XP_010934032.1 orthology 0.788 6 147 7.46e-47
bradi_pan_p042306 orthology 0.133 2 - -
cocnu_pan_p020678 orthology 0.804 6 146 9.78e-47
cocnu_pan_p024529 orthology 0.878 7 - -
musac_pan_p009117 orthology 0.751 6 149 8.57e-48
orysa_pan_p048607 orthology 0.189 3 216 2.37e-74
orysa_pan_p051674 orthology 0.652 3 - -
tritu_pan_p017403 ultra-paralogy 0.0256 0 - -
tritu_pan_p047012 ultra-paralogy 0.0095 0 - -