Gene tritu_pan_p013522
| Sequence ID | tritu_pan_p013522 add to my list | ||
|---|---|---|---|
| Species | Triticum turgidum | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 72aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 72 amino acids
>tritu_pan_p013522_TRITU MDGCLQVVELKVGMHCDRCIKSIKKAIKTIDDMESYQLEKETNKVTVTGNITAEEVVKAL QKIGKTVTYWGE
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP240412 | Unannotated cluster |
| 3 | GP342479 | Unannotated cluster |
| 4 | GP464531 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p013522
Represented sequence(s):
TRITU_Svevo_v2.0
TRITU_Zavitan_v1.1
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. TRIDC3Av2G200170.1 | 0.00 | 2.99 | 4.52 | 4.52 |
| 2. TraesCS3A02G347400.1 | 2.99 | 0.00 | 2.82 | 1.40 |
| 3. TraesCS3B02G379100.1 | 4.52 | 2.82 | 0.00 | 1.40 |
| 4. TraesCS3D02G341000.1 | 4.52 | 1.40 | 1.40 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| XP_008799824.1 | orthology | 0.842 | 4 | 98.2 | 5.84e-29 |
| XP_019706214.1 | orthology | 0.689 | 3 | 100 | 5.31e-30 |
| XP_019706215.1 | orthology | 0.709 | 3 | - | - |
| bradi_pan_p054645 | orthology | 0.14 | 1 | 132 | 1.62e-41 |
| musac_pan_p017294 | orthology | 0.882 | 4 | 100 | 3.86e-30 |