Gene tritu_pan_p014563
| Sequence ID | tritu_pan_p014563 add to my list | ||
|---|---|---|---|
| Species | Triticum turgidum | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 159aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 159 amino acids
>tritu_pan_p014563_TRITU MGILDAVSDMCACPTVRTRRHIKKRPQLETVEMKVRIDCEGCERRIRKAVDGIRGVTGVE VLPKQNKVAVTGYIDDPAKLMRRVARKTGKKVEPWPYVPYDVVPHPYAPGAYDKKAPPGY VRNVVADPDAAPLARASSTEVKYTSAFSDENPNAACAVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p014563
Represented sequence(s):
TRITU_Svevo_v2.0
TRITU_Zavitan_v1.1
| 1. | 2. | 3. | 4. | 5. | |
|---|---|---|---|---|---|
| 1. TRIDC6Bv2G012690.1 | 0.00 | 1.27 | -0.00 | -0.00 | 0.63 |
| 2. TRIDC6Av2G008770.1 | 1.27 | 0.00 | 1.27 | 1.27 | 1.91 |
| 3. TraesCS6A02G043000.1 | -0.00 | 1.27 | 0.00 | -0.00 | 0.63 |
| 4. TraesCS6B02G059000.1 | -0.00 | 1.27 | -0.00 | 0.00 | 0.63 |
| 5. TraesCS6D02G049600.1 | 0.63 | 1.91 | 0.63 | 0.63 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HORVU6Hr1G009000.1 | orthology | 0.0587 | 1 | 309 | 6.53e-109 |
| Mba04_g22800.1 | orthology | 0.414 | 3 | - | - |
| Mba04_g33020.1 | orthology | 0.454 | 3 | - | - |
| musac_pan_p005239 | orthology | 0.454 | 3 | - | - |
| musac_pan_p034720 | orthology | 0.455 | 3 | - | - |