Gene tritu_pan_p020571
| Sequence ID | tritu_pan_p020571 add to my list |
|---|---|
| Species | Triticum turgidum |
| Alias | No gene alias |
| Pangenome status | Core (2/2) |
| Length | 77aa |
Length: 77 amino acids
>tritu_pan_p020571_TRITU MATKCIIGALVGSLGIAYVCDTIVSDKKIFGGTVCKTATDKEWFQATDAKFQAWPRVAGP PVIMNPISRQNFIVKDP
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for tritu_pan_p020571
Represented sequence(s):
TRITU_Zavitan_v1.1
TRITU_Svevo_v2.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Dr18262 | orthology | 0.69 | 2 | - | - |
| HORVU2Hr1G123310.1 | orthology | 0.201 | 1 | - | - |
| HORVU7Hr1G008110.2 | orthology | 0.134 | 1 | 158 | 3.23e-52 |
| tritu_pan_p047458 | ultra-paralogy | 0.154 | 0 | - | - |