Gene tritu_pan_p029517
Sequence ID | tritu_pan_p029517 add to my list | ||
---|---|---|---|
Species | Triticum turgidum | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 148aa | ||
Gene Ontology |
![]()
|
Length: 148 amino acids
>tritu_pan_p029517_TRITU MTIVEMCVHMCCAGCEKKIRKAVERLEGVDAVEIDMEMQKVTVNGDVDQKKVLKTVRRTG KRAVLWPTPFIAGAGAGGAVNLLAQQHQYHPGGAQMYATHASGPTSSYNYYKHGYDDSRL YGANSAVVGGTRATDYFSDENPGGCSVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p029517
Represented sequence(s):
TRITU_Zavitan_v1.1
TRITU_Svevo_v2.0
1. | 2. | 3. | 4. | |
---|---|---|---|---|
1. TRIDC3Av2G177830.1 | 0.00 | 1.36 | 1.36 | 1.36 |
2. TRIDC3Bv2G155510.1 | 1.36 | 0.00 | -0.00 | 1.36 |
3. TraesCS3B02G329600.1 | 1.36 | -0.00 | 0.00 | 1.36 |
4. TraesCS3D02G295000.1 | 1.36 | 1.36 | 1.36 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU3Hr1G072940.2 | orthology | 0.0455 | 1 | 281 | 5.35e-99 |
Mba03_g16740.1 | orthology | 0.483 | 4 | - | - |
XP_008813766.1 | orthology | 0.594 | 5 | 164 | 5.8e-53 |
XP_010920018.1 | orthology | 0.607 | 6 | 161 | 1.44e-51 |
bradi_pan_p002062 | orthology | 0.166 | 2 | 224 | 1.34e-76 |
cocnu_pan_p020915 | orthology | 0.615 | 6 | - | - |
musac_pan_p001588 | orthology | 0.503 | 4 | 168 | 1.08e-54 |