Gene tritu_pan_p040052


Sequence ID tritu_pan_p040052  add to my list
Species Triticum turgidum
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 96aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 96 amino acids

>tritu_pan_p040052_TRITU
MDYRQFYCMTLRMSIDCNGCYQKIRRALLQMQELESHLIDRKHGRVSVWGAFSPQDVAIK
IRKRTNRRVEILELREAAGPGGGDEQGAGGGQMPPN




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for tritu_pan_p040052



Represented sequence(s):
TRITU_Zavitan_v1.1
TraesCS5D02G212700.1
Unrepresented genome(s):
TRITU_Svevo_v2.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
ORGLA09G0073900.1 orthology 0.398 3 - -
bradi_pan_p028263 orthology 0.335 2 140 9.26e-45
maize_pan_p009159 orthology 0.408 3 148 2.52e-48
musac_pan_p023320 orthology 0.728 3 - -
orysa_pan_p037625 orthology 0.505 3 - -
sorbi_pan_p029803 orthology 0.306 3 - -
tritu_pan_p004118 ultra-paralogy 0.0239 0 - -
tritu_pan_p024914 ultra-paralogy 0.0131 0 - -
tritu_pan_p048949 ultra-paralogy 0.0953 0 - -