GreenPhyl v5 - Gene tritu_pan

Gene tritu_pan_p047012

Sequence ID

tritu_pan_p047012 ^{add to my list}

Species

Triticum turgidum

Alias

No gene alias

Pangenome status

Dispensable (1/2)

Length

123aa

Gene Ontology

biological_process	metal ion transport GO:0030001 - metal ion transport

Gene Sequence
Gene Classification
Domain Pattern
Pangene Composition
Homolog Predictions

123 amino acids

>tritu_pan_p047012_TRITU
MGDLQIVLAGGTIEAQHVEMKVPLYSYGCEKKIKKALSNLKGIHSVQVDYHQQKVTVWGI
CNRNDVLAAVRRKRRAARFWGADQPDLGEDARLLGDAPKHYLRAFAAYRSRKSWKKLFPM
IRL

Clustering Level	Family ID	Family Name
1	Heavy metal transport/detoxification protein superfamily GP000323	Heavy metal transport/detoxification protein superfamily
2	Heavy metal transport/detoxification group1 GP015397	Heavy metal transport/detoxification group1
3	GP342521	Unannotated cluster
4	GP467872	Unannotated cluster

This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.

ID	Name	Type
Heavy metal-associated domain, HMA IPR006121	Heavy metal-associated domain, HMA	Domain
Heavy metal-associated domain superfamily IPR036163	Heavy metal-associated domain superfamily	Homologous_superfamily

IPR006121 IPR036163

IPR domains for tritu_pan_p047012

Represented sequence(s):

TRITU_Zavitan_v1.1

TraesCS2D02G392200.1

Unrepresented genome(s):

TRITU_Svevo_v2.0

	Homology			RBH
Similar Sequence ID	Type	Evolutionary distance	Node distance	score	e-value
HORVU2Hr1G093870.1	orthology	0.0096	1	-	-
Mba04_g24060.1	orthology	0.728	6	-	-
XP_008808278.1	orthology	0.814	6	-	-
XP_010919018.1	orthology	0.822	7	-	-
XP_010934032.1	orthology	0.78	6	-	-
bradi_pan_p042306	orthology	0.124	2	229	2.79e-79
cocnu_pan_p020678	orthology	0.796	6	-	-
cocnu_pan_p024529	orthology	0.869	7	-	-
musac_pan_p009117	orthology	0.743	6	-	-
orysa_pan_p048607	orthology	0.18	3	-	-
orysa_pan_p051674	orthology	0.644	3	-	-
tritu_pan_p012747	ultra-paralogy	0.0095	0	-	-
tritu_pan_p017403	ultra-paralogy	0.0182	0	-	-