Gene tritu_pan_p050141


Sequence ID tritu_pan_p050141  add to my list
Species Triticum turgidum
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 107aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 107 amino acids

>tritu_pan_p050141_TRITU
MSCGGCSGAVKRVLTKMEGVESFDIDMEQQKVTVKGNVKPEDVFQTVSKTGKKTAFWEAE
ATPAPDATPAAPAAEAAPAADAAPAPEAAPAADAAPAPEATPANTVA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for tritu_pan_p050141



Represented sequence(s):
TRITU_Zavitan_v1.1
TraesCS7B02G338200.1
Unrepresented genome(s):
TRITU_Svevo_v2.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba06_g17710.1 orthology 0.673 2 - -
musac_pan_p007187 orthology 0.649 2 - -
tritu_pan_p009809 ultra-paralogy 0.0502 0 - -