Gene vitvi_pan_p000499
| Sequence ID | vitvi_pan_p000499 add to my list | ||
|---|---|---|---|
| Species | Vitis vinifera | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 313aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 313 amino acids
>vitvi_pan_p000499_VITVI MGEKKQNKNEGEKKKNDGNGGAKKEDSGLITVVLKVDLHCEGCGSKVVKYLKGLDGVANA KADSDTNKVTVIGKVDPSMLREKLEQKTKKKVELLSPAPKKDKKNDDGGGGDKKAEKKPE KKAEDKKPKEPPVTTAVLKIDLHCAGCIDKIQRTVSKTKGVESKSIDKQKNLVTVTGTMD VKALVESLKDRLKRPVEIVPPKKDAGGGGGGEKKAKDGDKKADGGGKKEEGVKAEENYFL HESMPGFGFTAGPGQFYPPHPAHPAQMYAPPGYGYGAEYAPAYGPGYGYGYAAESPHAPQ MFSDENPNACSVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for vitvi_pan_p000499
Represented sequence(s):
VITVI_Carmenere_v1.0
VITVI_CabernetSauvignon_v1.0
VITVI_12X.2
| 1. | 2. | 3. | 4. | 5. | 6. | 7. | 8. | 9. | |
|---|---|---|---|---|---|---|---|---|---|
| 1. Vitvi06g01315.t01 | 0.00 | 0.64 | 0.64 | 0.32 | 0.32 | 0.43 | 0.43 | 0.32 | 1.95 |
| 2. VvCabSauv08_P0029F.ver1.0.g386920.m01 | 0.64 | 0.00 | 0.59 | 0.32 | 0.32 | -0.00 | -0.00 | 0.32 | 1.95 |
| 3. VvCabSauv08_H0029F_012.ver1.0.g127370.m01 | 0.64 | 0.59 | 0.00 | 0.32 | 0.32 | -0.00 | -0.00 | 0.32 | 1.95 |
| 4. VvCabSauv08_P0029F.ver1.0.g386920.m03 | 0.32 | 0.32 | 0.32 | 0.00 | -0.00 | -0.00 | -0.00 | -0.00 | 1.62 |
| 5. VvCabSauv08_H0029F_012.ver1.0.g127370.m03 | 0.32 | 0.32 | 0.32 | -0.00 | 0.00 | -0.00 | -0.00 | -0.00 | 1.62 |
| 6. VvCabSauv08_P0029F.ver1.0.g386920.m02 | 0.43 | -0.00 | -0.00 | -0.00 | -0.00 | 0.00 | -0.00 | -0.00 | 1.72 |
| 7. VvCabSauv08_H0029F_012.ver1.0.g127370.m02 | 0.43 | -0.00 | -0.00 | -0.00 | -0.00 | -0.00 | 0.00 | -0.00 | 1.72 |
| 8. VvCarFPS02VCR702_v1_PsGc_456.ver1_0.g222590.m01 | 0.32 | 0.32 | 0.32 | -0.00 | -0.00 | -0.00 | -0.00 | 0.00 | 1.62 |
| 9. VvCarFPS02VCR702_v1_PsGc_136.ver1_0.g080710.m01 | 1.95 | 1.95 | 1.95 | 1.62 | 1.62 | 1.72 | 1.72 | 1.62 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G28090.1 | orthology | 1 | 5 | - | - |
| Cg8g019570.1 | orthology | 0.722 | 3 | 189 | 5.16e-58 |
| Cm049010.1 | orthology | 0.72 | 4 | - | - |
| Cm049020.1 | orthology | 0.75 | 3 | - | - |
| Cs8g15890.1 | orthology | 0.723 | 4 | - | - |
| Cs8g15900.1 | orthology | 0.777 | 3 | - | - |
| DCAR_015174 | orthology | 1 | 4 | - | - |
| Manes.04G015400.1 | orthology | 0.869 | 2 | 188 | 2.5e-57 |
| Manes.11G150800.1 | orthology | 0.881 | 2 | - | - |
| Manes.11G150900.1 | orthology | 0.907 | 2 | - | - |
| brana_pan_p035445 | orthology | 1 | 6 | - | - |
| brana_pan_p036106 | orthology | 1 | 6 | - | - |
| braol_pan_p002645 | orthology | 1 | 6 | - | - |
| braol_pan_p042787 | orthology | 1 | 6 | - | - |
| brarr_pan_p026563 | orthology | 1 | 6 | - | - |
| thecc_pan_p013140 | orthology | 0.844 | 3 | 166 | 3.3e-49 |