Gene vitvi_pan_p020280
| Sequence ID | vitvi_pan_p020280 add to my list | ||
|---|---|---|---|
| Species | Vitis vinifera | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 292aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 292 amino acids
>vitvi_pan_p020280_VITVI MIPELEKPRVTEIQVRMDCNGCVQKIKKALYGINGIYDLYIDFPQQKLTIIGWADPEKIM KAIKKTRKIATICSHTEPTDPATKPPEQAPEGGGPPPAEAANPPPAEAPQAEAAPPAEPP KDPPPPENPPPEATPAPAAADVNAGNPARPKDVEEVHVIYHHPPEYGYRYGYGHRYGGHW NNYSNVQGLQQEPPPTVYTNVQGVHHEPPPTMYTNVQGLHHEPPPPVYVTHRYNTYKPPP YITEYEYIRSPPRHAHYSRMDRYSEDYRNVNNSNGNITSMFSDENPNACRIV
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP047778 | Unannotated cluster |
| 4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for vitvi_pan_p020280
Represented sequence(s):
VITVI_CabernetSauvignon_v1.0
VITVI_12X.2
VITVI_Carmenere_v1.0
| 1. | 2. | 3. | 4. | 5. | 6. | |
|---|---|---|---|---|---|---|
| 1. Vitvi05g00064.t01 | 0.00 | -0.00 | 0.34 | 0.72 | -0.00 | 7.81 |
| 2. VvCabSauv08_H0114F_004.ver1.0.g212830.m01 | -0.00 | 0.00 | 0.34 | 0.72 | -0.00 | 7.81 |
| 3. VvCabSauv08_P0114F.ver1.0.g503130.m01 | 0.34 | 0.34 | 0.00 | 1.09 | 0.34 | 7.36 |
| 4. VvCabSauv08_H0114F_004.ver1.0.g212830.m02 | 0.72 | 0.72 | 1.09 | 0.00 | 0.72 | 7.22 |
| 5. VvCarFPS02VCR702_v1_PsGc_107.ver1_0.g015100.m01 | -0.00 | -0.00 | 0.34 | 0.72 | 0.00 | 7.81 |
| 6. VvCarFPS02VCR702_v1_Hc0048F_022.ver1_0.g521950.m01 | 7.81 | 7.81 | 7.36 | 7.22 | 7.81 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg9g002000.1 | orthology | 0.424 | 5 | 243 | 3.92e-79 |
| Cm229420.1 | orthology | 0.426 | 5 | 244 | 1.77e-79 |
| Cs9g03680.1 | orthology | 0.441 | 4 | 238 | 2.82e-77 |
| FvH4_4g18950.1 | orthology | 0.451 | 3 | 202 | 1e-63 |
| Manes.15G008800.1 | orthology | 0.453 | 4 | 242 | 3.2e-79 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04327.1 | orthology | 0.688 | 2 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_31773.1 | orthology | 0.549 | 3 | 204 | 1.91e-65 |
| cicar_pan_p002360 | orthology | 0.765 | 3 | 158 | 3.54e-47 |
| maldo_pan_p004517 | orthology | 0.461 | 3 | 254 | 3.83e-83 |
| maldo_pan_p022412 | orthology | 0.479 | 3 | - | - |
| medtr_pan_p024125 | orthology | 0.788 | 3 | 127 | 3.86e-35 |
| phavu.G19833.gnm2.ann1.Phvul.003G108900.1 | orthology | 0.762 | 3 | 173 | 5.66e-53 |
| soybn_pan_p005812 | orthology | 0.686 | 2 | - | - |
| soybn_pan_p009634 | orthology | 0.72 | 3 | - | - |
| soybn_pan_p012740 | orthology | 0.52 | 3 | 175 | 1.32e-53 |
| thecc_pan_p016610 | orthology | 0.391 | 3 | 234 | 2.05e-75 |