Gene vitvi_pan_p021528
| Sequence ID | vitvi_pan_p021528 add to my list | ||
|---|---|---|---|
| Species | Vitis vinifera | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 70aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 70 amino acids
>vitvi_pan_p021528_VITVI MANVVELKVGLHCEECIKKILKAIKKIEDIETYNIDTQLNKVIVTGNVTEEEVIRVLQKI GKRASNWQSE
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP240412 | Unannotated cluster |
| 3 | GP342479 | Unannotated cluster |
| 4 | GP464531 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for vitvi_pan_p021528
Represented sequence(s):
VITVI_Carmenere_v1.0
VITVI_12X.2
VITVI_CabernetSauvignon_v1.0
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. Vitvi13g01901.t01 | 0.00 | -0.00 | -0.00 | -0.00 |
| 2. VvCabSauv08_H0005F_051.ver1.0.g058850.m02 | -0.00 | 0.00 | -0.00 | -0.00 |
| 3. VvCabSauv08_P0005F.ver1.0.g301140.m02 | -0.00 | -0.00 | 0.00 | -0.00 |
| 4. VvCarFPS02VCR702_v1_Hc0008F_025.ver1_0.g441750.m01 | -0.00 | -0.00 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AUR62022965-RA | orthology | 0.537 | 5 | 115 | 2.04e-35 |
| Bv2_044470_umgd.t1 | orthology | 0.475 | 5 | 116 | 2.75e-36 |
| maldo_pan_p020043 | orthology | 0.25 | 3 | 123 | 7.53e-39 |
| thecc_pan_p001547 | orthology | 0.259 | 2 | 124 | 2.07e-39 |
| vitvi_pan_p042470 | orthology | 0 | 1 | - | - |