Gene vitvi_pan_p027453


Sequence ID vitvi_pan_p027453  add to my list
Species Vitis vinifera
Alias No gene alias
Pangenome status Core (3/3)
Length 134aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 134 amino acids

>vitvi_pan_p027453_VITVI
MGKLSFGRVLDCFCLSSGSTSCFCINSLEAQDEFERKPLIVSDDDRQLVRLKDVIAEKQT
LAFQLKPKMVVLRVSMHCNGCARKVEKHISKMEGVTSYQVDLESKMVVVVGDIVPFEVLE
SVSKVKVAELWKTP



Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for vitvi_pan_p027453




  1. 2. 3. 4. 5. 6.
1. Vitvi11g00365.t01 0.00 0.75 -0.00 0.75 0.75 0.75
2. VvCabSauv08_H0010F_021.ver1.0.g078800.m01 0.75 0.00 0.75 1.50 1.50 -0.00
3. VvCabSauv08_P0010F.ver1.0.g327390.m01 -0.00 0.75 0.00 0.75 0.75 0.75
4. VvCarFPS02VCR702_v1_Hc0000F_069.ver1_0.g411120.m01 0.75 1.50 0.75 0.00 -0.00 1.50
5. VvCarFPS02VCR702_v1_Hc0000F_109.ver1_0.g414780.m01 0.75 1.50 0.75 -0.00 0.00 1.50
6. VvCarFPS02VCR702_v1_PsGc_271.ver1_0.g135660.m01 0.75 -0.00 0.75 1.50 1.50 0.00