Gene vitvi_pan_p029254
| Sequence ID | vitvi_pan_p029254 add to my list | ||
|---|---|---|---|
| Species | Vitis vinifera | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 326aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 326 amino acids
>vitvi_pan_p029254_VITVI MGEEEKKPEEKKMEGKKAEEEKKEAKQEKAEKPSEEKKEEKAAPEEGKAAKAEPPPPPPE IVLRVYMHCEGCARKVRRCLKGFDGVEDVITDCKSQKVVVKGEKADPLKVLERVQRKNHR QVELLSPIPKPPAEDEKKPEEKEAPKPEEKKEEPQVITVVLKVHMHCEACAQEIQKRIGR MKGVEFAEPDLKASQVTVKGVFDPPKLVEYVYKRTGKHAVIVKQEPEKKEEEKGKDGKEE KKEEKGEGEKEKKGGGEEENKGKKPGEEAAAEKADVEAETKVVELKKNEFLYNYNYPYYP PRYYMEQNPYPSQIFSDENPNACSVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for vitvi_pan_p029254
Represented sequence(s):
VITVI_Carmenere_v1.0
VITVI_12X.2
VITVI_CabernetSauvignon_v1.0
| 1. | 2. | 3. | 4. | 5. | 6. | 7. | |
|---|---|---|---|---|---|---|---|
| 1. Vitvi17g00087.t01 | 0.00 | 0.65 | -0.00 | -0.00 | 1.62 | 0.65 | -0.00 |
| 2. VvCabSauv08_H0085F_006.ver1.0.g190000.m01 | 0.65 | 0.00 | 0.62 | 0.64 | 2.44 | -0.00 | 0.62 |
| 3. VvCabSauv08_P0085F.ver1.0.g470320.m03 | -0.00 | 0.62 | 0.00 | -0.00 | 1.62 | 0.62 | -0.00 |
| 4. VvCabSauv08_P0085F.ver1.0.g470320.m01 | -0.00 | 0.64 | -0.00 | 0.00 | 1.63 | 0.64 | -0.00 |
| 5. VvCabSauv08_P0085F.ver1.0.g470320.m02 | 1.62 | 2.44 | 1.62 | 1.63 | 0.00 | 2.44 | 1.62 |
| 6. VvCarFPS02VCR702_v1_Hc0314F_001.ver1_0.g673250.m01 | 0.65 | -0.00 | 0.62 | 0.64 | 2.44 | 0.00 | 0.62 |
| 7. VvCarFPS02VCR702_v1_PsGc_1165.ver1_0.g037580.m01 | -0.00 | 0.62 | -0.00 | -0.00 | 1.62 | 0.62 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg7g010440.1 | orthology | 0.386 | 6 | 237 | 3.51e-76 |
| Cm018610.1 | orthology | 0.388 | 6 | 237 | 5.1e-76 |
| FvH4_5g08650.1 | orthology | 0.337 | 3 | 297 | 1.03e-99 |
| Manes.06G121400.1 | orthology | 0.308 | 4 | 289 | 1.03e-96 |
| Manes.14G049200.1 | orthology | 0.323 | 4 | - | - |
| maldo_pan_p003643 | orthology | 0.356 | 3 | - | - |
| maldo_pan_p029843 | orthology | 0.357 | 3 | 287 | 1.43e-95 |
| orange1.1t02606.2 | orthology | 0.392 | 5 | 239 | 5.85e-77 |
| thecc_pan_p013659 | orthology | 0.32 | 3 | 298 | 8.22e-100 |