Gene vitvi_pan_p029850
| Sequence ID | vitvi_pan_p029850 add to my list | ||
|---|---|---|---|
| Species | Vitis vinifera | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 179aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 179 amino acids
>vitvi_pan_p029850_VITVI MATALERRLASFFSFITCSNYFLYQDNHKGIDHINFKMPKGRPLSLQTVELKVRMCCTGC ERVVKNAIFKLRGVDSVEVDLGMEKVTVVGYVDRNKVLKAVRRSGKRAEFWPYPDPPLYF TSSNDYFKDLTNDYKESYNYWRHGYNVADRHGTIPPTHRGDDKVSNMFNDDNVNACCLM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for vitvi_pan_p029850
Represented sequence(s):
VITVI_Carmenere_v1.0
VITVI_12X.2
VITVI_CabernetSauvignon_v1.0
| 1. | 2. | 3. | 4. | 5. | 6. | |
|---|---|---|---|---|---|---|
| 1. Vitvi02g00276.t01 | 0.00 | 0.56 | -0.00 | 0.80 | -0.00 | -0.00 |
| 2. VvCabSauv08_H0002F_098.ver1.0.g030960.m01 | 0.56 | 0.00 | 0.56 | -0.00 | 0.80 | 0.71 |
| 3. VvCabSauv08_P0002F.ver1.0.g282100.m01 | -0.00 | 0.56 | 0.00 | 0.80 | -0.00 | -0.00 |
| 4. VvCabSauv08_H0002F_098.ver1.0.g030960.m02 | 0.80 | -0.00 | 0.80 | 0.00 | 0.80 | 0.80 |
| 5. VvCabSauv08_P0002F.ver1.0.g282100.m02 | -0.00 | 0.80 | -0.00 | 0.80 | 0.00 | -0.00 |
| 6. VvCarFPS02VCR702_v1_Hc0133F_002.ver1_0.g606580.m01 | -0.00 | 0.71 | -0.00 | 0.80 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| vitvi_pan_p036653 | ultra-paralogy | 0.0554 | 0 | - | - |