Gene vitvi_pan_p043411
| Sequence ID | vitvi_pan_p043411 add to my list |
|---|---|
| Species | Vitis vinifera |
| Alias | No gene alias |
| Pangenome status | Specific (1/3) |
| Length | 65aa |
Length: 65 amino acids
>vitvi_pan_p043411_VITVI MHPSTSHEASYYATPPPQYSYAYMHPGPWTEPPPSDFDSNPSSVHPPSDSFQFFSDENPN ACSLM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
Unrepresented genome(s):
VITVI_CabernetSauvignon_v1.0
VITVI_12X.2
VITVI_Carmenere_v1.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| MELO3C015311.2.1 | orthology | 1 | 2 | - | - |
| cucsa_pan_p016664 | orthology | 1 | 2 | - | - |
| maldo_pan_p020139 | orthology | 1 | 2 | - | - |
| maldo_pan_p023511 | orthology | 1 | 2 | - | - |
| maldo_pan_p042780 | orthology | 1 | 2 | - | - |
| maldo_pan_p049042 | orthology | 1 | 2 | - | - |
| maldo_pan_p050592 | orthology | 1 | 2 | - | - |
| vitvi_pan_p009555 | ultra-paralogy | 0.001 | 0 | - | - |