Gene vitvi_pan_p043537
Sequence ID | vitvi_pan_p043537 add to my list | ||
---|---|---|---|
Species | Vitis vinifera | ||
Alias | No gene alias | ||
Pangenome status | Specific (1/3) | ||
Length | 76aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 76 amino acids
>vitvi_pan_p043537_VITVI MSCEGCVGAVKRVLGKMEGVESFDIDLKEQKVTVKGNVQPDAVLKTVSKTGKKTSFWEAE ASAEPGAKPAETVPVA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for vitvi_pan_p043537
Represented sequence(s):
Unrepresented genome(s):
VITVI_CabernetSauvignon_v1.0
VITVI_12X.2
VITVI_Carmenere_v1.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cajca.ICPL87119.gnm1.ann1.C.cajan_24641.1 | orthology | 0.426 | 4 | - | - |
cicar_pan_p009659 | orthology | 0.501 | 3 | 112 | 1.14e-34 |
medtr_pan_p015003 | orthology | 0.502 | 3 | - | - |
phavu.G19833.gnm2.ann1.Phvul.007G103800.1 | orthology | 0.414 | 4 | - | - |
soybn_pan_p011435 | orthology | 0.396 | 3 | - | - |
soybn_pan_p033763 | orthology | 0.397 | 3 | - | - |
thecc_pan_p006409 | orthology | 0.227 | 2 | - | - |
vitvi_pan_p027163 | ultra-paralogy | 0.0011 | 0 | - | - |
vitvi_pan_p043448 | ultra-paralogy | 0.0184 | 0 | - | - |