Gene AT1G01170.1


Sequence ID AT1G01170.1  add to my list
Species Arabidopsis thaliana
Alias Q2HIQ2
Length 83aa
PubMed References
Open Display PubMed Reference(s) (2)
Accession Description
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
11130712 		Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.



Length: 83 amino acids

>AT1G01170.1_ARATH
MASGGKAKYIIGALIGSFGISYIFDKVISDNKIFGGTTPGTVSNKEWWAATDEKFQAWPR
TAGPPVVMNPISRQNFIVKTRPE




Clustering Level Family ID Family Name
1
Unknown function duf1138 family
GP002478		 Unknown function duf1138 family
2 GP018276 Unannotated cluster
3 GP042981 Unannotated cluster
4 GP072479 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Protein of unknown function DUF1138
IPR009515 		Protein of unknown function DUF1138 Family

IPR009515
Figure 1: IPR domains for AT1G01170.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
FvH4_3g28670.1 orthology 0.441 4 132.1 1.6e-31
FvH4_5g27260.1 orthology 0.566 4 - -
brana_pan_p024714 orthology 0.11 3 - -
brana_pan_p051583 orthology 0.0698 1 163 2.89e-54
braol_pan_p040163 orthology 0.11 3 160 3.07e-53
brarr_pan_p004667 orthology 0.664 2 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_09476.1 orthology 0.829 6 122.9 1.1e-28
cicar_pan_p021438 orthology 0.873 4 - -
cicar_pan_p021882 orthology 0.873 4 125 1.39e-39
maldo_pan_p050830 orthology 0.424 4 133 1.61e-42
medtr_pan_p001744 orthology 0.886 5 114 3.73e-35
medtr_pan_p009141 orthology 0.888 5 - -
phavu.G19833.gnm2.ann1.Phvul.001G134700.2 orthology 0.827 7 118.2 2.4e-27
soybn_pan_p000766 orthology 0.88 7 123 1.34e-38
soybn_pan_p008913 orthology 0.896 7 - -
soybn_pan_p014436 orthology 0.908 7 - -
soybn_pan_p035092 orthology 0.895 7 - -