Gene AT1G23000.2


Sequence ID AT1G23000.2  add to my list
Species Arabidopsis thaliana
Alias A2RVM8
Length 418aa
PubMed References
Open Display PubMed Reference(s) (5)
Accession Description
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
11130712 		Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Functional annotation of a full-length Arabidopsis cDNA collection.
11910074 		Functional annotation of a full-length Arabidopsis cDNA collection.
Metallochaperone-like genes in Arabidopsis thaliana.
21072340 		Metallochaperone-like genes in Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
23368984 		Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 418 amino acids

>AT1G23000.2_ARATH
MLLLECNLNSKIQNLMRKCGQVAVTFKCQSSLTHSTSFQISEQKSLNPKPLHLIAYSSKA
MTKDEDFKLLKIQTFSLRVNIHCEGCNKKVKKLLQRIEGVCHVKIEAEHQKVTVSGSVDS
ATLINKLVKAGKHAELWSPNPNQNQPQKPKTNDFIKNVNQKGQKQGSAKSGIEACKPKNG
PKGAAFVAEEDGDGSEEEDGDVQFPKPANQQQQQNVVNAKKNSGGAAMNNGNNGVNAASK
KVNQKQSNHNQNTQQVMAAMRMRTAGKMSTGVEANEIGALMGLAGFNGATNAVNHPPNGI
QQQLQAPPLNNVNGVTNHNLTNSNGGMMMNMNGYNNHHPMNMQSRQMMHQPQQMMYQRSS
FVPASSNGYYYNYTPSPYSYYPYYPYASDQYQQQSSHSHATNMSSEEDAGNNNSCNIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP023608 Unannotated cluster
3 GP040483 Unannotated cluster
4 GP070015 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT1G23000.2



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
MELO3C005316.2.1 orthology 0.902 3 126.3 3.8e-29
brana_pan_p046794 orthology 0.154 3 367 2.1e-125
braol_pan_p030024 orthology 0.172 2 352 2.06e-119
brarr_pan_p010319 orthology 0.16 3 359 1.79e-122
cucsa_pan_p016602 orthology 0.938 3 127 5.37e-33