Gene AT1G29100.2


Sequence ID AT1G29100.2  add to my list
Species Arabidopsis thaliana
Alias Q9LP41
Length 147aa
PubMed References
Open Display PubMed Reference(s) (4)
Accession Description
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
11130712 		Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Metallochaperone-like genes in Arabidopsis thaliana.
21072340 		Metallochaperone-like genes in Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
23368984 		Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 147 amino acids

>AT1G29100.2_ARATH
MTTVVEMEVPMDCPGCENKVRKALEKMNGVHDVQIDIKQQRVTVTGSAEQKKVLKVARNV
TKRDICLWSYPYHPESNGYNDRYFKKKFRKRINMSVNGEKVSSYNYHKHGYHGHEHGYYQ
ERPYSGLINPSASSMFSEENPHFCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT1G29100.2



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU7Hr1G080490.1 orthology 1 3 - -
ORGLA06G0147600.1 orthology 1 3 - -
Sspon.08G0007770-1A orthology 1 4 - -
Sspon.08G0007770-2B orthology 1 4 - -
brana_pan_p026075 orthology 0.216 3 237 8.5e-82
braol_pan_p020359 orthology 0.216 3 237 7.71e-82
brarr_pan_p033912 orthology 0.229 2 233 2.29e-80
maize_pan_p005331 orthology 1 3 - -
maize_pan_p039298 orthology 1 3 - -
orysa_pan_p021817 orthology 1 3 - -
sorbi_pan_p008889 orthology 1 4 - -
tritu_pan_p011159 orthology 1 2 - -
tritu_pan_p011712 orthology 1 2 - -
tritu_pan_p042703 orthology 1 3 - -