Gene AT1G30473.1


Sequence ID AT1G30473.1  add to my list
Species Arabidopsis thaliana
Alias Q1G3T0
Length 239aa
PubMed References
Open Display PubMed Reference(s) (2)
Accession Description
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
11130712 		Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 239 amino acids

>AT1G30473.1_ARATH
MANPNQSVRTCILKVDLKCCIGCQKKASMKLQSISGVEEVEYNIEKGLMTVRGDVEPMAL
VRKLNKHDRKTELFSVKYQLDDDDLNSDSEDYSSSDSTNSSYDPKPMERQFQEKMMQQKK
KKSGILKMLSLLWCFSSKSKVVQPLPMRNRNWHVPSKFENVPPGFGFNSTTSSQLRPPHP
MMPYPPMMQPPMMQQQRPLMMQQQAQVPMPPNVNMFQSAPQPFKMHPKLHYGEQKQVVT




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP534741 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT1G30473.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg7g023400.1 orthology 1 4 - -
Cm012520.1 orthology 1 4 - -
Cs7g01670.1 orthology 1 3 - -
MELO3C015862.2.1 orthology 1 6 - -
brana_pan_p050558 orthology 0.725 2 - -
braol_pan_p028920 orthology 0.698 2 128 6.77e-36
cucsa_pan_p009937 orthology 1 6 - -
maldo_pan_p011650 orthology 1 5 - -
thecc_pan_p012699 orthology 1 3 - -