Gene AT1G66240.1


Sequence ID AT1G66240.1  add to my list
Species Arabidopsis thaliana
Alias No gene alias
Length 106aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 106 amino acids

>AT1G66240.1_ARATH
MLKDLFQAVSYQNTASLSLFQALSVVESKAMSQTVVLRVAMTCEGCVGAVKRVLGKMEGV
ESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAFWEAEGETAKA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT1G66240.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
brana_pan_p001603 orthology 0.117 1 - -
brana_pan_p049599 orthology 0.134 2 - -
brana_pan_p070944 orthology 0.117 2 139 1.58e-44
braol_pan_p000393 orthology 0.117 2 139 1.44e-44
brarr_pan_p023356 orthology 0.134 2 137 1.05e-43