Gene AT1G66240.1
Sequence ID | AT1G66240.1 add to my list | ||
---|---|---|---|
Species | Arabidopsis thaliana | ||
Alias | No gene alias | ||
Length | 106aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 106 amino acids
>AT1G66240.1_ARATH MLKDLFQAVSYQNTASLSLFQALSVVESKAMSQTVVLRVAMTCEGCVGAVKRVLGKMEGV ESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAFWEAEGETAKA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AT1G66240.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
brana_pan_p001603 | orthology | 0.117 | 1 | - | - |
brana_pan_p049599 | orthology | 0.134 | 2 | - | - |
brana_pan_p070944 | orthology | 0.117 | 2 | 139 | 1.58e-44 |
braol_pan_p000393 | orthology | 0.117 | 2 | 139 | 1.44e-44 |
brarr_pan_p023356 | orthology | 0.134 | 2 | 137 | 1.05e-43 |