Gene AT2G28090.1


Sequence ID AT2G28090.1  add to my list
Species Arabidopsis thaliana
Alias Q9ZUV1
Length 245aa
PubMed References
Open Display PubMed Reference(s) (5)
Accession Description
Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.
10617197 		Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.
Analysis of the cDNAs of hypothetical genes on Arabidopsis chromosome 2 reveals numerous transcript variants.
16244158 		Analysis of the cDNAs of hypothetical genes on Arabidopsis chromosome 2 reveals numerous transcript variants.
Metallochaperone-like genes in Arabidopsis thaliana.
21072340 		Metallochaperone-like genes in Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
23368984 		Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 245 amino acids

>AT2G28090.1_ARATH
MENPQVCECYHGDVEEEKKKKQNNTTSPVHVVLKIDFHCDGCIARIVRLSRRLEGVETVR
ADPDSNKLTLIGFIMDPVKIAEKLQKKSKKKVELISPKPKKDTKENNEKKANDKTQTVVA
VTTVVLKVNCSCDGCIKRIQKAVSTTKGVYQVKMDKEKETVTVMGTMDIKSVTDNLKRKL
KKTVQVVPEKKKKKKDKDNAEVNTKVGSPCQPGNGCTHGIGPYRFMEGPMTGFFSEEDQS
YCSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT2G28090.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg8g019570.1 orthology 1 7 - -
Cm049010.1 orthology 1 8 - -
Cm049020.1 orthology 1 7 - -
Cs8g15890.1 orthology 1 8 - -
Cs8g15900.1 orthology 1 7 - -
DCAR_015174 orthology 1 2 - -
Manes.04G015400.1 orthology 1 6 145.2 6.1e-35
Manes.11G150800.1 orthology 1 6 - -
Manes.11G150900.1 orthology 1 6 - -
brana_pan_p035445 orthology 0.388 2 - -
brana_pan_p036106 orthology 0.387 2 281 3.98e-96
braol_pan_p002645 orthology 0.382 2 256 1.31e-86
braol_pan_p042787 orthology 0.405 2 - -
brarr_pan_p026563 orthology 0.395 2 273 4.35e-93
thecc_pan_p013140 orthology 0.996 3 - -
vitvi_pan_p000499 orthology 1 5 - -